Vicente Central

Authority Score
N/A
Needs both scores
Brand Authority
13.59
Domain Authority
N/A
Not in Common Crawl

Revolve (Seed) > Rehab (L1) > Vicente Central (L2)

Rank #382,166 of 2,883,072

Rank Brand Canonical Score Type
382,163 Bergen Engines bergenengines 0.00000475
382,164 Payless Supermarkets paylesssupersmarkets 0.00000475
382,165 Pattaya Walking Street Night Market pattayawalkingstreetnightmarket 0.00000475
382,166 Vicente Central vicentecentral 0.00000475
382,167 Adriatic Tuna adriatictuna 0.00000475
382,168 Leeds Playhouse leedsplayhouse 0.00000475
382,169 Hasuda hasuda 0.00000475

Gemini AI Recall

AI Rank#382,166
TypeDiscovered via Association

Inbound

Pointed to by

#Brand
77 Rehab

Brand Neighbourhood