Payless Supermarkets
Authority Score
N/A
Needs both scores
Brand Authority
13.59
Domain Authority
N/A
Not in Common Crawl
Rank #382,164 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 382,161 | Tiburclean | tiburclean | 0.00000475 | |
| 382,162 | Life and Times of Zorba | lifeandtimesofzorba | 0.00000475 | |
| 382,163 | Bergen Engines | bergenengines | 0.00000475 | |
| 382,164 | Payless Supermarkets | paylesssupersmarkets | 0.00000475 | |
| 382,165 | Pattaya Walking Street Night Market | pattayawalkingstreetnightmarket | 0.00000475 | |
| 382,166 | Vicente Central | vicentecentral | 0.00000475 | |
| 382,167 | Adriatic Tuna | adriatictuna | 0.00000475 |
Gemini AI Recall
| AI Rank | #382,164 |
| Type | Discovered via Association |