Bergen Engines
Authority Score
18.06
Brand Authority
13.59
Domain Authority
22.52
Rank #382,163 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 382,160 | Central Arkansas | centralarkansas | 0.00000475 | |
| 382,161 | Tiburclean | tiburclean | 0.00000475 | |
| 382,162 | Life and Times of Zorba | lifeandtimesofzorba | 0.00000475 | |
| 382,163 | Bergen Engines | bergenengines | 0.00000475 | |
| 382,164 | Payless Supermarkets | paylesssupersmarkets | 0.00000475 | |
| 382,165 | Pattaya Walking Street Night Market | pattayawalkingstreetnightmarket | 0.00000475 | |
| 382,166 | Vicente Central | vicentecentral | 0.00000475 |
Gemini AI Recall
| AI Rank | #382,163 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 22.52 |
| PageRank | 0.0000000196 |
| Harmonic Centrality | 12,287,579.0000 |
| PR Rank | #1,971,904 |
| Hosts in Domain | 2 |