Venuse Estates Land
Authority Score
N/A
Needs both scores
Brand Authority
4.65
Domain Authority
N/A
Not in Common Crawl
Rank #1,444,144 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 1,444,141 | Sciron Logistics | scironlogistics | 0.000000196 | |
| 1,444,142 | Understatement | understatement | 0.000000196 | |
| 1,444,143 | Suicide Prevention | suicideprevention | 0.000000196 | |
| 1,444,144 | Venuse Estates Land | venuseestatesland | 0.000000196 | |
| 1,444,145 | The Circulatory System | thecirculatorysystem | 0.000000196 | |
| 1,444,146 | Jewish Family and Children's Service | jewishfamilyandchildrensservice | 0.000000196 | |
| 1,444,147 | UKBIC | ukbic | 0.000000196 |
Gemini AI Recall
| AI Rank | #1,444,144 |
| Type | Discovered via Association |