Jewish Family and Children's Service
Authority Score
20.80
Brand Authority
4.65
Domain Authority
36.96
Rank #1,444,146 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 1,444,143 | Suicide Prevention | suicideprevention | 0.000000196 | |
| 1,444,144 | Venuse Estates Land | venuseestatesland | 0.000000196 | |
| 1,444,145 | The Circulatory System | thecirculatorysystem | 0.000000196 | |
| 1,444,146 | Jewish Family and Children's Service | jewishfamilyandchildrensservice | 0.000000196 | |
| 1,444,147 | UKBIC | ukbic | 0.000000196 | |
| 1,444,148 | GKN Driveline North America | gkndrivelinenorthamerica | 0.000000196 | |
| 1,444,149 | Red Rock Adventure | redrockadventure | 0.000000196 |
Gemini AI Recall
| AI Rank | #1,444,146 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 36.96 |
| PageRank | 0.000000200 |
| Harmonic Centrality | 16,579,120.0000 |
| PR Rank | #132,409 |
| Hosts in Domain | 14 |