UKBIC
Authority Score
13.72
Brand Authority
4.65
Domain Authority
22.80
Rank #1,444,147 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 1,444,144 | Venuse Estates Land | venuseestatesland | 0.000000196 | |
| 1,444,145 | The Circulatory System | thecirculatorysystem | 0.000000196 | |
| 1,444,146 | Jewish Family and Children's Service | jewishfamilyandchildrensservice | 0.000000196 | |
| 1,444,147 | UKBIC | ukbic | 0.000000196 | |
| 1,444,148 | GKN Driveline North America | gkndrivelinenorthamerica | 0.000000196 | |
| 1,444,149 | Red Rock Adventure | redrockadventure | 0.000000196 | |
| 1,444,150 | Pasta Val di Trento | pastavalditrento | 0.000000196 |
Gemini AI Recall
| AI Rank | #1,444,147 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 22.80 |
| PageRank | 0.0000000203 |
| Harmonic Centrality | 13,154,739.0000 |
| PR Rank | #1,871,021 |
| Hosts in Domain | 2 |