The Body Shop Vitamin E Face Cream
Authority Score
22.01
Brand Authority
0.36
Domain Authority
43.65
Rank #2,734,392 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,734,389 | Guess Gift | guessgift | 0.000000000940 | |
| 2,734,390 | Yoplait Nourish Pecan | yoplaitnourishpecan | 0.000000000940 | |
| 2,734,391 | JW.org Jesus | jworgjesus | 0.000000000940 | |
| 2,734,392 | The Body Shop Vitamin E Face Cream | thebodyshopskincarevitaminecreamfacecream | 0.000000000940 | |
| 2,734,393 | Flauta | flauta | 0.000000000940 | |
| 2,734,394 | Bentshark | bentshark | 0.000000000940 | |
| 2,734,395 | RectorSeal Vendor | rectorsealvendor | 0.000000000940 |
Gemini AI Recall
| AI Rank | #2,734,392 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 43.65 |
| PageRank | 0.000000747 |
| Harmonic Centrality | 14,912,324.0000 |
| PR Rank | #37,848 |
| Hosts in Domain | 35 |
Known Variants
| Variant | Type |
|---|---|
| the-body-shop-skin-care-vitamin-e-cream-face-cream | format |