Flauta

Authority Score
N/A
Needs both scores
Brand Authority
0.36
Domain Authority
N/A
Not in Common Crawl

taco扩展 (Seed) > taco_station (L1) > Flauta (L2)

Rank #2,734,393 of 2,883,072

Rank Brand Canonical Score Type
2,734,390 Yoplait Nourish Pecan yoplaitnourishpecan 0.000000000940
2,734,391 JW.org Jesus jworgjesus 0.000000000940
2,734,392 The Body Shop Vitamin E Face Cream thebodyshopskincarevitaminecreamfacecream 0.000000000940
2,734,393 Flauta flauta 0.000000000940
2,734,394 Bentshark bentshark 0.000000000940
2,734,395 RectorSeal Vendor rectorsealvendor 0.000000000940
2,734,396 Kiehl's Since 1851 Creamy Eye Treatment with Avocado kiehlssince1851skincreamyeyeavocadofacecream 0.000000000939

Gemini AI Recall

AI Rank#2,734,393
TypeDiscovered via Association