Guess Gift
Authority Score
21.83
Brand Authority
0.36
Domain Authority
43.30
Rank #2,734,389 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,734,386 | Lush Intergalactic Bath Bomb | lushcosmeticsbathbombintergalacticbluebathbombbody | 0.000000000940 | |
| 2,734,387 | Petey’s Seasonal | peteysseasonal | 0.000000000940 | |
| 2,734,388 | TVC Directing | tvcdirecting | 0.000000000940 | |
| 2,734,389 | Guess Gift | guessgift | 0.000000000940 | |
| 2,734,390 | Yoplait Nourish Pecan | yoplaitnourishpecan | 0.000000000940 | |
| 2,734,391 | JW.org Jesus | jworgjesus | 0.000000000940 | |
| 2,734,392 | The Body Shop Vitamin E Face Cream | thebodyshopskincarevitaminecreamfacecream | 0.000000000940 |
Gemini AI Recall
| AI Rank | #2,734,389 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 43.30 |
| PageRank | 0.000000690 |
| Harmonic Centrality | 14,543,581.0000 |
| PR Rank | #40,443 |
| Hosts in Domain | 26 |