Texas Monthly
Authority Score
24.40
Brand Authority
0.36
Domain Authority
48.43
Rank #2,731,221 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,731,218 | MAC Cosmetics Lipstick (Velvet Teddy Matte Lipstick) | maccosmeticslipstickvelvetteddymattelipstick | 0.00000000108 | |
| 2,731,219 | Pusen | pusen | 0.00000000108 | |
| 2,731,220 | Maginarium | maginarium | 0.00000000108 | |
| 2,731,221 | Texas Monthly | texasmonthy | 0.00000000108 | |
| 2,731,222 | Faculty of Sports and Exercise Medicine | facultysportsandexercisemedicine | 0.00000000108 | |
| 2,731,223 | Sephora Beauty Store (Black Card Member Beauty) | sephorabeautystoreblackcardmemberbeauty | 0.00000000108 | |
| 2,731,224 | Maggi | maggibrand | 0.00000000108 |
Gemini AI Recall
| AI Rank | #2,731,221 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 48.43 |
| PageRank | 0.00000214 |
| Harmonic Centrality | 17,102,812.0000 |
| PR Rank | #15,472 |
| Hosts in Domain | 21 |