Pusen
Authority Score
8.52
Brand Authority
0.36
Domain Authority
16.67
Rank #2,731,219 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,731,216 | iX35 Fuel Cell | ix35fuelcell | 0.00000000108 | |
| 2,731,217 | Caramel Hatch | caramelhatch | 0.00000000108 | |
| 2,731,218 | MAC Cosmetics Lipstick (Velvet Teddy Matte Lipstick) | maccosmeticslipstickvelvetteddymattelipstick | 0.00000000108 | |
| 2,731,219 | Pusen | pusen | 0.00000000108 | |
| 2,731,220 | Maginarium | maginarium | 0.00000000108 | |
| 2,731,221 | Texas Monthly | texasmonthy | 0.00000000108 | |
| 2,731,222 | Faculty of Sports and Exercise Medicine | facultysportsandexercisemedicine | 0.00000000108 |
Gemini AI Recall
| AI Rank | #2,731,219 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 16.67 |
| PageRank | 0.00000000817 |
| Harmonic Centrality | 11,849,251.0000 |
| PR Rank | #5,895,999 |
| Hosts in Domain | 3 |