Maginarium

Authority Score
N/A
Needs both scores
Brand Authority
0.36
Domain Authority
N/A
Not in Common Crawl

generaleneric (Seed) > Aldi Specialty (L1) > Maginarium (L2)

Rank #2,731,220 of 2,883,072

Rank Brand Canonical Score Type
2,731,217 Caramel Hatch caramelhatch 0.00000000108
2,731,218 MAC Cosmetics Lipstick (Velvet Teddy Matte Lipstick) maccosmeticslipstickvelvetteddymattelipstick 0.00000000108
2,731,219 Pusen pusen 0.00000000108
2,731,220 Maginarium maginarium 0.00000000108
2,731,221 Texas Monthly texasmonthy 0.00000000108
2,731,222 Faculty of Sports and Exercise Medicine facultysportsandexercisemedicine 0.00000000108
2,731,223 Sephora Beauty Store (Black Card Member Beauty) sephorabeautystoreblackcardmemberbeauty 0.00000000108

Gemini AI Recall

AI Rank#2,731,220
TypeDiscovered via Association