Pembroke Audit Services — AI Brand Authority Index

Authority Score

N/A

Needs both scores

Brand Authority

1.47

Domain Authority

N/A

Not in Common Crawl

Rank #2,316,514 of 2,883,072

Rank	Brand	Canonical	Score	Type
2,316,511	Qatar Airways Festival	qatarairwaysqatarairwaysfestival	0.0000000313
2,316,512	Hyland Guardian	hylandguardian	0.0000000313
2,316,513	Pasta Party	pastaparty	0.0000000313
2,316,514	Pembroke Audit Services	pembrokeauditservices	0.0000000313
2,316,515	The Bureau Properties	thebureauproperties	0.0000000313
2,316,516	Pentamount Academy	pentamountacademy	0.0000000313
2,316,517	Honey Brook	honeybrook	0.0000000313

Gemini AI Recall

AI Rank	#2,316,514
Type	Discovered via Association