Pasta Party — AI Brand Authority Index

Authority Score

N/A

Needs both scores

Brand Authority

1.47

Domain Authority

N/A

Not in Common Crawl

Rank #2,316,513 of 2,883,072

Rank	Brand	Canonical	Score	Type
2,316,510	Roberto Garcia Management	robertogarciamanagement	0.0000000313
2,316,511	Qatar Airways Festival	qatarairwaysqatarairwaysfestival	0.0000000313
2,316,512	Hyland Guardian	hylandguardian	0.0000000313
2,316,513	Pasta Party	pastaparty	0.0000000313
2,316,514	Pembroke Audit Services	pembrokeauditservices	0.0000000313
2,316,515	The Bureau Properties	thebureauproperties	0.0000000313
2,316,516	Pentamount Academy	pentamountacademy	0.0000000313

Gemini AI Recall

AI Rank	#2,316,513
Type	Discovered via Association