Hyland Guardian
Authority Score
24.21
Brand Authority
1.47
Domain Authority
46.96
Rank #2,316,512 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,316,509 | Bethany Cafe | bethanycafe | 0.0000000313 | |
| 2,316,510 | Roberto Garcia Management | robertogarciamanagement | 0.0000000313 | |
| 2,316,511 | Qatar Airways Festival | qatarairwaysqatarairwaysfestival | 0.0000000313 | |
| 2,316,512 | Hyland Guardian | hylandguardian | 0.0000000313 | |
| 2,316,513 | Pasta Party | pastaparty | 0.0000000313 | |
| 2,316,514 | Pembroke Audit Services | pembrokeauditservices | 0.0000000313 | |
| 2,316,515 | The Bureau Properties | thebureauproperties | 0.0000000313 |
Gemini AI Recall
| AI Rank | #2,316,512 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 46.96 |
| PageRank | 0.00000153 |
| Harmonic Centrality | 16,806,158.0000 |
| PR Rank | #20,391 |
| Hosts in Domain | 26 |