TVC Film Creator — AI Brand Authority Index

Authority Score

N/A

Needs both scores

Brand Authority

0.35

Domain Authority

N/A

Not in Common Crawl

Rank #2,736,391 of 2,883,072

Rank	Brand	Canonical	Score	Type
2,736,388	KP Medical Group	kpmedicalgroup	0.000000000861
2,736,389	Safe Catch	safecatchsalmoncannedwildpinkalaskafishmeatcanned	0.000000000861
2,736,390	Namoh Amrutulya	namohamrutulya	0.000000000861
2,736,391	TVC Film Creator	tvcfilmcreator	0.000000000861
2,736,392	GE PECT	gepetct	0.000000000861
2,736,393	Tuna the Tide	tuna-the-tide-canned-fish-wild-caught-alaska-fish-meat-canned	0.000000000861
2,736,394	Baidu Xiaoyao	baiduxiaoyao	0.000000000861

Gemini AI Recall

AI Rank	#2,736,391
Type	Discovered via Association

Known Variants

Variant	Type
tvc_filmcreator	format