Namoh Amrutulya
Authority Score
N/A
Needs both scores
Brand Authority
0.35
Domain Authority
N/A
Not in Common Crawl
Rank #2,736,390 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,736,387 | Egg Model | eggmodel | 0.000000000862 | |
| 2,736,388 | KP Medical Group | kpmedicalgroup | 0.000000000861 | |
| 2,736,389 | Safe Catch | safecatchsalmoncannedwildpinkalaskafishmeatcanned | 0.000000000861 | |
| 2,736,390 | Namoh Amrutulya | namohamrutulya | 0.000000000861 | |
| 2,736,391 | TVC Film Creator | tvcfilmcreator | 0.000000000861 | |
| 2,736,392 | GE PECT | gepetct | 0.000000000861 | |
| 2,736,393 | Tuna the Tide | tuna-the-tide-canned-fish-wild-caught-alaska-fish-meat-canned | 0.000000000861 |
Gemini AI Recall
| AI Rank | #2,736,390 |
| Type | Discovered via Association |