Fontana Buffet
Authority Score
N/A
Needs both scores
Brand Authority
0.35
Domain Authority
N/A
Not in Common Crawl
Rank #2,735,023 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,735,020 | Tsehay Bank | tsehaybank | 0.000000000915 | |
| 2,735,021 | Hammerhead | hammerheadcyclingcompkaroo2gpscomputercycling | 0.000000000915 | |
| 2,735,022 | Bhadrati Iron and Steel Works | bhadratiironandsteelworks | 0.000000000915 | |
| 2,735,023 | Fontana Buffet | fontanabuffet | 0.000000000915 | |
| 2,735,024 | AXA Wichita | axawichita | 0.000000000915 | |
| 2,735,025 | Bonaroma | bonaroma | 0.000000000915 | |
| 2,735,026 | Stages Cycling Power Meter Arm (Left Crank Meter) | stagescyclingpowermeterarmleftcrankmetercycling | 0.000000000915 |
Gemini AI Recall
| AI Rank | #2,735,023 |
| Type | Discovered via Association |