AXA Wichita
Authority Score
21.90
Brand Authority
0.35
Domain Authority
43.45
Rank #2,735,024 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 2,735,021 | Hammerhead | hammerheadcyclingcompkaroo2gpscomputercycling | 0.000000000915 | |
| 2,735,022 | Bhadrati Iron and Steel Works | bhadratiironandsteelworks | 0.000000000915 | |
| 2,735,023 | Fontana Buffet | fontanabuffet | 0.000000000915 | |
| 2,735,024 | AXA Wichita | axawichita | 0.000000000915 | |
| 2,735,025 | Bonaroma | bonaroma | 0.000000000915 | |
| 2,735,026 | Stages Cycling Power Meter Arm (Left Crank Meter) | stagescyclingpowermeterarmleftcrankmetercycling | 0.000000000915 | |
| 2,735,027 | Western Excelsior | westernexcelsior | 0.000000000914 |
Gemini AI Recall
| AI Rank | #2,735,024 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 43.45 |
| PageRank | 0.000000717 |
| Harmonic Centrality | 16,826,376.0000 |
| PR Rank | #39,311 |
| Hosts in Domain | 49 |