Trio Leuchten
Authority Score
22.75
Brand Authority
15.28
Domain Authority
30.23
Rank #297,179 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 297,176 | RBC Capital Markets Specialty Finance | rbccapitalmarketsspecialtyfinance | 0.00000782 | |
| 297,177 | NordicTrack S22i | nordictracks22i | 0.00000782 | |
| 297,178 | Ferco | ferco | 0.00000782 | |
| 297,179 | Trio Leuchten | trioleuchten | 0.00000782 | |
| 297,180 | DMCA | dmca | 0.00000782 | |
| 297,181 | Omnidata | omnidata | 0.00000782 | |
| 297,182 | The Anda Brands | theandabrands | 0.00000782 |
Gemini AI Recall
| AI Rank | #297,179 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 30.23 |
| PageRank | 0.0000000588 |
| Harmonic Centrality | 12,799,000.0000 |
| PR Rank | #466,575 |
| Hosts in Domain | 7 |
Known Variants
| Variant | Type |
|---|---|
| TrioLeuchten | format |