Soya Sol Skin

Authority Score
N/A
Needs both scores
Brand Authority
0.36
Domain Authority
N/A
Not in Common Crawl

雀巢 (omitted due to script) (Seed) > SoyaSol (L1) > Soya Sol Skin (L2)

Rank #2,732,034 of 2,883,072

Rank Brand Canonical Score Type
2,732,031 Forex Lifestyle forexlifestyle 0.00000000104
2,732,032 Ollywood Cafe ollywoodcafe 0.00000000104
2,732,033 Hellasly hellasly 0.00000000104
2,732,034 Soya Sol Skin soyasolskin 0.00000000104
2,732,035 Mama Shelter mamashelters 0.00000000104
2,732,036 Nutrisystem nutrisystemmealsweightdeliverydietfooddelivery 0.00000000104
2,732,037 Le Loft d'Un Espresso leloftedunespresso 0.00000000104

Gemini AI Recall

AI Rank#2,732,034
TypeDiscovered via Association