Nauru Airlines
Authority Score
13.93
Brand Authority
3.64
Domain Authority
24.23
Rank #1,678,262 of 2,883,072
| Rank | Brand | Canonical | Score | Type |
|---|---|---|---|---|
| 1,678,259 | Wyndham at Fairfield Sapphire Valley | wyndhamatfairfieldsapphirevalley | 0.000000122 | |
| 1,678,260 | Versaturf | versaturf | 0.000000122 | |
| 1,678,261 | Brasserie des Forêts | brasseriedesforets | 0.000000122 | |
| 1,678,262 | Nauru Airlines | nauruairlines | 0.000000122 | |
| 1,678,263 | Huaxia Holding | huaxiaholding | 0.000000122 | |
| 1,678,264 | Pass the Mickey | passthemickey | 0.000000122 | |
| 1,678,265 | Cecil and Lou | cecilandlou | 0.000000122 |
Gemini AI Recall
| AI Rank | #1,678,262 |
| Type | Discovered via Association |
Common Crawl Link Graph
| Domain Authority | 24.23 |
| PageRank | 0.0000000258 |
| Harmonic Centrality | 13,862,037.0000 |
| PR Rank | #1,431,353 |
| Hosts in Domain | 3 |