HNO University

Authority Score
N/A
Needs both scores
Brand Authority
0.36
Domain Authority
N/A
Not in Common Crawl

Hno (Seed) > Hno (L1) > HNO University (L2)

Rank #2,732,039 of 2,883,072

Rank Brand Canonical Score Type
2,732,036 Nutrisystem nutrisystemmealsweightdeliverydietfooddelivery 0.00000000104
2,732,037 Le Loft d'Un Espresso leloftedunespresso 0.00000000104
2,732,038 HyDeals hydeals 0.00000000104
2,732,039 HNO University hnouniversity 0.00000000104
2,732,040 Peter Span Software peterspansoftware 0.00000000104
2,732,041 HelloFresh hellofreshmealkitboxcookfreshfooddelivery 0.00000000104
2,732,042 Ramage Kitchen ramagekitchen 0.00000000104

Gemini AI Recall

AI Rank#2,732,039
TypeDiscovered via Association

Inbound

Pointed to by

#Brand
91 Hno

Brand Neighbourhood